PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00012248-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 523aa    MW: 55298.7 Da    PI: 9.7445
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00012248-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.24.8e-15408451548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v eL++eNk+L+ +
  PSME_00012248-RA 408 RRQRRMIKNRESAARSRARKQAYTVELEAEVTELKEENKELRRK 451
                       79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-12404468IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.231406451IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11408452No hitNo description
PfamPF001707.1E-13408451IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-14408453No hitNo description
CDDcd147075.52E-24408453No hitNo description
PROSITE patternPS000360411426IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MGSNEDSRFL GAAAAAAAAA YPVGGKMGSF SLARQASIYS LTLEEFQNSL GEPGKNFGSM  60
NMEELLKNIW TAEEGQAMAA AMGAAEGTTV GNLASQASLQ RQGSLTLPRT LSRKTVDEVW  120
RDLYRENTYG NGNGNGNGNG NANGNGNGHV NAQRQATFGE ITLEDFLVKA GVVREESTEP  180
YGRLGNDQFG GFGGNSMERN ANGLGISNAL GLGFSERGVS NGEVINNGAQ GTASISLSPS  240
NNALSNQAML DAMNLEALKS SQQQTGWLNN HYRPPIVQQQ QQQQHQQILQ HQQQQQVADA  300
AAAIYGSSVK RQGNGALMGS PLGGGLGLSP TMNGGIGNGL QGGLGTGLAC LGATALTIGA  360
VSPANQLSSD GMGTSHGDNS TLSPIPYGLD VGVRGRKRGG PVEKVVERRQ RRMIKNRESA  420
ARSRARKQAY TVELEAEVTE LKEENKELRR KQVIAANKRS QLPKGKSSCS RAQAQVHSSA  480
FNVHAVLHTV LHAVLLFQRL MFTHLWLGLH SVLHAAVHAV LHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0525241e-109FJ052524.1 Pinus taeda isolate 7644 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525251e-109FJ052525.1 Pinus taeda isolate 7642 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525261e-109FJ052526.1 Pinus taeda isolate 7653 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525271e-109FJ052527.1 Pinus taeda isolate 7649 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525281e-109FJ052528.1 Pinus taeda isolate 7643 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525291e-109FJ052529.1 Pinus taeda isolate 7648 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525301e-109FJ052530.1 Pinus taeda isolate 7640 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525311e-109FJ052531.2 Pinus taeda isolate 7639 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525331e-109FJ052533.2 Pinus taeda isolate 7646 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525341e-109FJ052534.1 Pinus taeda isolate 7652 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525351e-109FJ052535.1 Pinus taeda isolate 7655 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525361e-109FJ052536.2 Pinus taeda isolate 7641 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525371e-109FJ052537.2 Pinus taeda isolate 7645 anonymous locus 0_13576_02 genomic sequence.
GenBankFJ0525381e-109FJ052538.1 Pinus taeda isolate 7647 anonymous locus 0_13576_02 genomic sequence.
GenBankJQ2619091e-109JQ261909.1 Pinus radiata isolate 13471 hypothetical protein (0_13576_02) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826228.11e-100PREDICTED: bZIP transcription factor TRAB1 isoform X1
RefseqXP_011628944.11e-100PREDICTED: bZIP transcription factor TRAB1 isoform X1
RefseqXP_011628985.11e-100PREDICTED: bZIP transcription factor TRAB1 isoform X2
TrEMBLA0A0D6QWI01e-178A0A0D6QWI0_ARACU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.14e-33abscisic acid responsive element-binding factor 1